biolip::3oghB has 151 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-47 146.6 3.2 7e-46 142.3 3.2 1.9 1 biolip::3oghB Domain annotation for each sequence (and alignments): >> biolip::3oghB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.3 3.2 7e-46 7e-46 4 158 .. 8 147 .. 5 148 .. 0.95 Alignments for each domain: == domain 1 score: 142.3 bits; conditional E-value: 7e-46 DUF892 4 elfideLrDayaaEkqalkalpkmakaaes.peLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkdaal 98 e+++d+LrDa+a+Ekqa+++l++ma+++++ peL+a++eqHl+eT++qi +le ++ r + + s +k d m++ ++de+vk+ + biolip::3oghB 8 EHYHDWLRDAHAMEKQAESMLESMASRIDNyPELRARIEQHLSETKNQIVQLETILDRNDISRSVIK-DSMSK------------MADEIVKGSI- 89 89*****************************************************************.66655............4688999***. PP DUF892 99 iaaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 +++++e++Eia+Y++L+a+A+++g++ ++e++l+eEk ++++L +++++++++++ biolip::3oghB 90 --SGYVFEQFEIACYTSLLAAAKNAGDTASIPTIEAILNEEKHMADWLIQHIPQTTEKFL 147 ..*****************************************************99875 PP
Or compare biolip::3oghB to CDD or PaperBLAST