biolip::4leiA has 375 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-37 115.0 0.1 2.5e-37 114.1 0.1 1.4 1 biolip::4leiA Domain annotation for each sequence (and alignments): >> biolip::4leiA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 114.1 0.1 2.5e-37 2.5e-37 2 145 .] 235 372 .. 234 372 .. 0.96 Alignments for each domain: == domain 1 score: 114.1 bits; conditional E-value: 2.5e-37 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 ++l +a+lD E++++l++d+ elp nvR+ ++vPl+ ll++c++i+Hhg +++ ta GvPq++lp +d+ ra+ +a++Gag+vl biolip::4leiA 235 RLLRGAARLDVEVIATLSDDE----VELPSNVRVHEYVPLNELLESCSVIIHHGSTTTQETATVNGVPQLILP--WDESRRAELLADRGAGLVLD 323 678899**********77655....579********************************************8..******************** PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 + + t d ++ +a+++++p++ a+aa +++ei ++PsP++++++le+l biolip::4leiA 324 PATFTEDDVRGQLARLLDEPSFAANAALIRREIEESPSPHDIVPRLEKL 372 **********************************************987 PP
Or compare biolip::4leiA to CDD or PaperBLAST