biolip::5ivxE has 194 amino acids
Query: DUF1968 [M=81]
Accession: PF09291.14
Description: Domain of unknown function (DUF1968)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-41 124.7 1.7 1e-40 124.0 1.7 1.4 1 biolip::5ivxE
Domain annotation for each sequence (and alignments):
>> biolip::5ivxE
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 124.0 1.7 1e-40 1e-40 1 74 [. 120 193 .. 120 194 .] 0.98
Alignments for each domain:
== domain 1 score: 124.0 bits; conditional E-value: 1e-40
DUF1968 1 PavYqLkspkssdtsvCLfTDFdsqvnvsqskeseviktdktvldmksldsKSngavaWsnksdfkCqdtfkee 74
PavYqLk+p+s+d+++CLfTDFdsq+nv +++es +++tdk vldmk++dsKSnga+aWsn+++f+Cqd+fke+
biolip::5ivxE 120 PAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKET 193
9***********************************************************************95 PP
Or compare biolip::5ivxE to CDD or PaperBLAST