biolip::5nrg3 has 65 amino acids
Query: TIGR00001 [M=63]
Accession: TIGR00001
Description: rpmI_bact: ribosomal protein bL35
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-29 87.5 11.6 3.2e-29 87.3 11.6 1.0 1 biolip::5nrg3
Domain annotation for each sequence (and alignments):
>> biolip::5nrg3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.3 11.6 3.2e-29 3.2e-29 1 63 [] 1 63 [. 1 63 [. 0.99
Alignments for each domain:
== domain 1 score: 87.3 bits; conditional E-value: 3.2e-29
TIGR00001 1 pKmKTkkaaaKRFkvtgsGkikrkkagkrHlltkKsskrkRqLrkkalvsksdlkrvkllLpy 63
pKmKT+++aaKR k t+sG++kr++a+++Hl+++Ks+k+kRqLrk lvsksd krvk+lL y
biolip::5nrg3 1 PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQLLAY 63
9************************************************************87 PP
Or compare biolip::5nrg3 to CDD or PaperBLAST