biolip::5trdA has 219 amino acids
Query: CTP-dep_RFKase [M=121] Accession: PF01982.22 Description: Domain of unknown function DUF120 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-48 149.9 0.1 2.5e-48 149.3 0.1 1.3 1 biolip::5trdA Domain annotation for each sequence (and alignments): >> biolip::5trdA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 149.3 0.1 2.5e-48 2.5e-48 1 121 [] 95 214 .. 95 214 .. 0.99 Alignments for each domain: == domain 1 score: 149.3 bits; conditional E-value: 2.5e-48 CTP-dep_RFKase 1 VvsGlgeGayyvslegykeqfeeklgfePfpGTLNvkldeeslelrelleklkgieiegfeeeertfgavkalpakingieaavvvperthyped 95 V+sG+geG+yyv +++y qf+eklg+ P+ GTLN+k+d++sl + ++++ ++gi+iegf++e+rtfg+vka+paki++i++ v++pert y +d biolip::5trdA 95 VTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVY-TD 188 89******************************************************************************************.9* PP CTP-dep_RFKase 96 vlEiiapvkLreklklkdgdevevev 121 v+Eii++++Lre+++l+dgd+v+vev biolip::5trdA 189 VIEIISDKYLREEINLHDGDRVSVEV 214 ************************97 PP
Or compare biolip::5trdA to CDD or PaperBLAST