biolip::6al9B has 91 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-23 67.9 0.7 5e-23 67.7 0.7 1.1 1 biolip::6al9B
Domain annotation for each sequence (and alignments):
>> biolip::6al9B
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.7 0.7 5e-23 5e-23 1 79 [] 9 84 .. 9 84 .. 0.94
Alignments for each domain:
== domain 1 score: 67.7 bits; conditional E-value: 5e-23
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+eId++D+el +Ll +R+e+a +ia +K+ + p++ p+Re+e+l+rl + ++l+ e+++ +++e+++ sr++Q+
biolip::6al9B 9 RAEIDALDNELSDLLDKRLEIALKIALIKQ--ESPIYCPKREQEILKRLSQRD-FKHLNGEILTGFYTEVFKISRKFQE 84
99***************************6..569****************43.578********************96 PP
Or compare biolip::6al9B to CDD or PaperBLAST