biolip::6i4yA has 429 amino acids
Query: UPF0203 [M=69]
Accession: PF05254.16
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.8e-29 87.1 2.0 6.5e-29 86.3 2.0 1.4 1 biolip::6i4yA
Domain annotation for each sequence (and alignments):
>> biolip::6i4yA
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.3 2.0 6.5e-29 6.5e-29 1 57 [. 371 427 .. 371 429 .] 0.97
Alignments for each domain:
== domain 1 score: 86.3 bits; conditional E-value: 6.5e-29
UPF0203 1 aslapeCtelKekYdkCFnkWysekflkgkskeeeCeklfkeYqeCvqkalkekgie 57
+s+++ Ct++K++Yd+CFn+W++ekflkg+s+ ++C++lfk+Yq+Cvqka+kek+i
biolip::6i4yA 371 NSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIP 427
699***************************************************996 PP
Or compare biolip::6i4yA to CDD or PaperBLAST