biolip::6rh6A has 138 amino acids
Query: DUF1681 [M=158] Accession: PF07933.18 Description: Protein of unknown function (DUF1681) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-58 182.1 0.0 3.5e-58 181.9 0.0 1.0 1 biolip::6rh6A Domain annotation for each sequence (and alignments): >> biolip::6rh6A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.9 0.0 3.5e-58 3.5e-58 1 125 [. 12 137 .. 12 138 .] 0.97 Alignments for each domain: == domain 1 score: 181.9 bits; conditional E-value: 3.5e-58 DUF1681 1 iervllvakevhvYkippltsskgyraadWtakepiwtgrlrvvekgkkvdikLedkktgelfaaapve.tkeaavekvlDSsRyFvlrvedekgr 95 +e+vl+v+++v+vY+ipp++s++gyra+dW+ ++p wtgrlr+++kgk++ ikLedk +gelfa+apve ave+v+DSsRyFv+r++d +gr biolip::6rh6A 12 YESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFAQAPVEqYPGIAVETVTDSSRYFVIRIQDGTGR 107 799*****************************************************************9755689********************* PP DUF1681 96 kaflGigFeeRsdafdfnvalqdaekrlkk 125 +af+GigF++R dafdfnv+lqd++k++k+ biolip::6rh6A 108 SAFIGIGFTDRGDAFDFNVSLQDHFKWVKQ 137 ***************************997 PP
Or compare biolip::6rh6A to CDD or PaperBLAST