biolip::6tcvB has 397 amino acids
Query: DUF1735 [M=120] Accession: PF08522.14 Description: Domain of unknown function (DUF1735) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-12 33.3 2.8 4.4e-12 33.0 0.4 2.4 2 biolip::6tcvB Domain annotation for each sequence (and alignments): >> biolip::6tcvB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.0 0.4 4.4e-12 4.4e-12 45 115 .. 28 89 .. 4 93 .. 0.83 2 ? -1.8 0.1 0.27 0.27 52 81 .. 220 248 .. 213 258 .. 0.78 Alignments for each domain: == domain 1 score: 33.0 bits; conditional E-value: 4.4e-12 DUF1735 45 vtlevdeslldeYnkangtnykllPedsytlessevtikaGsvssapvkiklkdldkld.gktYvlPlrits 115 +++++d+++l++Ynka++t++ l P+d +t++ + +a+v+ ++++ ++l+ +ktY++P+ i++ biolip::6tcvB 28 AKVKIDAAYLETYNKAHNTDFALYPQDLVTFA----------ILTAEVEMTIRAGEGLQeDKTYAIPVAIDE 89 57888**************************5..........556779999999777777*********986 PP == domain 2 score: -1.8 bits; conditional E-value: 0.27 DUF1735 52 slldeYnkangtnykllPedsytlessevt 81 +++++Yn g ny l ++s l++ ++t biolip::6tcvB 220 QYCKAYN-LDGVNYADLYSNSPDLSNPSLT 248 6889999.8899998888888888777766 PP
Or compare biolip::6tcvB to CDD or PaperBLAST