biolip::6xz0A has 250 amino acids
Query: AadA_C [M=103]
Accession: PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-24 71.2 0.0 5.5e-24 70.6 0.0 1.3 1 biolip::6xz0A
Domain annotation for each sequence (and alignments):
>> biolip::6xz0A
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.6 0.0 5.5e-24 5.5e-24 1 100 [. 148 244 .. 148 247 .. 0.91
Alignments for each domain:
== domain 1 score: 70.6 bits; conditional E-value: 5.5e-24
AadA_C 1 evldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveef 96
e+l+++p +d+++ai+++ eel+++ ++de++ +LtL+R+++t+ tg+i++Kd A++ + e+ P e+r+ + A + ylg e++e+ +e+v+
biolip::6xz0A 148 ELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLG---ENIEWTNENVNLT 240
699*****************************************************************************...5666666666666 PP
AadA_C 97 akym 100
+y+
biolip::6xz0A 241 INYL 244
6665 PP
Or compare biolip::6xz0A to CDD or PaperBLAST