PaperBLAST – Find papers about a protein or its homologs

 

Align biolip::7f2zA to PF13826 (DUF4188)

biolip::7f2zA has 339 amino acids

Query:       DUF4188  [M=118]
Accession:   PF13826.10
Description: Domain of unknown function (DUF4188)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    9.9e-16   44.4   1.6      1e-12   34.6   0.2    2.4  2  biolip::7f2zA  


Domain annotation for each sequence (and alignments):
>> biolip::7f2zA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    8.7   0.1   0.00011   0.00011      51     110 ..      72     129 ..      18     134 .. 0.79
   2 !   34.6   0.2     1e-12     1e-12      35     115 ..     234     325 ..     220     329 .. 0.81

  Alignments for each domain:
  == domain 1  score: 8.7 bits;  conditional E-value: 0.00011
        DUF4188  51 srevllvqYwrsveeLeafAkseeHreawrefnkkvkkngavgifHEtYvveagayesiY 110
                     ++ ++  Yw +    +++  ++e +++w+   kk+ +n+ +g + E+ +++ ++ e++ 
  biolip::7f2zA  72 YQDSIFLAYWDEPATFKSWVADPEVQKWWSG--KKIDENSPIGYWSEVTTIPIDHFETLH 129
                    46678899****************9999986..6699***********999999999876 PP

  == domain 2  score: 34.6 bits;  conditional E-value: 1e-12
        DUF4188  35 ekk.elGlLgaeslil......asrevllvqYwrsveeLeafAk.seeHreawrefnkkvkk...ngavgifHEtYvveagayesiYvnmpp 115
                    e+  e+G+++++ +          ++ +++ Y+ s+ +Le++++ +++H+  + +f++++k+   + +++++HE+ v++++ +e iYvn++p
  biolip::7f2zA 234 ENAsETGCISSKLVYEqthdgeIVDKSCVIGYYLSMGHLERWTHdHPTHKAIYGTFYEMLKRhdfKTELALWHEVSVLQSKDIELIYVNCHP 325
                    4444778887777663356666668899****************8899*********99998566789**********************64 PP



Or compare biolip::7f2zA to CDD or PaperBLAST