biolip::7ung0 has 52 amino acids
Query: CFAP95 [M=195]
Accession: PF15139.10
Description: Protein CFAP95
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-27 82.9 0.2 1.6e-27 82.7 0.2 1.0 1 biolip::7ung0
Domain annotation for each sequence (and alignments):
>> biolip::7ung0
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.7 0.2 1.6e-27 1.6e-27 152 195 .] 1 44 [. 1 44 [. 0.98
Alignments for each domain:
== domain 1 score: 82.7 bits; conditional E-value: 1.6e-27
CFAP95 152 yslvhrkcrsqftdlegskrvGintwqDesgiyansevkqklye 195
ys+vhrkcrsqftdl+gskr+Gintw+Desgiyans+vkqkly+
biolip::7ung0 1 YSIVHRKCRSQFTDLNGSKRFGINTWHDESGIYANSDVKQKLYP 44
9******************************************6 PP
Or compare biolip::7ung0 to CDD or PaperBLAST