biolip::8dyeB has 43 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-26 79.4 3.4 1.1e-26 79.3 3.4 1.0 1 biolip::8dyeB
Domain annotation for each sequence (and alignments):
>> biolip::8dyeB
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 79.3 3.4 1.1e-26 1.1e-26 9 50 .] 2 43 .] 1 43 [] 0.97
Alignments for each domain:
== domain 1 score: 79.3 bits; conditional E-value: 1.1e-26
DUF1674 9 aakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50
+++p ++f++dvnp t+E gGp+gpEPtRygDWerkGr++DF
biolip::8dyeB 2 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 43
68999************************************* PP
Or compare biolip::8dyeB to CDD or PaperBLAST