biolip::8pnhA has 386 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-14 40.5 1.9 1.1e-13 37.8 0.2 2.5 2 biolip::8pnhA Domain annotation for each sequence (and alignments): >> biolip::8pnhA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.8 0.2 1.1e-13 1.1e-13 15 78 .. 243 306 .. 239 307 .. 0.95 2 ? 1.6 0.1 0.02 0.02 34 64 .. 351 380 .. 334 384 .. 0.75 Alignments for each domain: == domain 1 score: 37.8 bits; conditional E-value: 1.1e-13 CM_2 15 laeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78 + +R+ la+++a++K + + p+ d Re++v++ + ++ ++lgl++ +e++fr+ i++s+ +Q biolip::8pnhA 243 IDQRLLLAQAVARAKWNVQAPIEDLGREAQVIQAAVKEGAALGLPKVWIETVFRAQIEASKTVQ 306 789************98999*****************888*********************999 PP == domain 2 score: 1.6 bits; conditional E-value: 0.02 CM_2 34 lpvldpeReeevlerlregaeelgldpeave 64 d++R ++v + +r+ + ++ l+p+a++ biolip::8pnhA 351 TVLNDEARKADVARAMRALE-ARALSPQAAT 380 35679999999999999943.4668887776 PP
Or compare biolip::8pnhA to CDD or PaperBLAST