biolip::8pnjA has 390 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-13 36.6 0.0 5.9e-13 35.4 0.0 1.6 1 biolip::8pnjA
Domain annotation for each sequence (and alignments):
>> biolip::8pnjA
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 35.4 0.0 5.9e-13 5.9e-13 9 78 .. 5 72 .. 2 73 .. 0.94
Alignments for each domain:
== domain 1 score: 35.4 bits; conditional E-value: 5.9e-13
CM_2 9 relleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
+ l +L++eR++l+ e+a+yK ++lp+ d +Re+ vler + + ldp ++++f + + +a+Q
biolip::8pnjA 5 QTLYQLMSERLALMPEVAKYKWHHNLPIEDLAREAMVLERTVS--RTTVLDPIHTKTFFGLQMTAAKAIQ 72
57899**************************************..4478******************999 PP
Or compare biolip::8pnjA to CDD or PaperBLAST