biolip::9c4g2 has 67 amino acids
Query: TIGR00001 [M=63]
Accession: TIGR00001
Description: rpmI_bact: ribosomal protein bL35
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-27 81.7 8.6 1.9e-27 81.6 8.6 1.0 1 biolip::9c4g2
Domain annotation for each sequence (and alignments):
>> biolip::9c4g2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.6 8.6 1.9e-27 1.9e-27 1 61 [. 1 61 [. 1 63 [. 0.98
Alignments for each domain:
== domain 1 score: 81.6 bits; conditional E-value: 1.9e-27
TIGR00001 1 pKmKTkkaaaKRFkvtgsGkikrkkagkrHlltkKsskrkRqLrkkalvsksdlkrvkllL 61
pKmK++++ +KRFkvtgsGk+ ++kagkrHl+++Kss+ +R+L++++++sk+++++vk+lL
biolip::9c4g2 1 PKMKSHSGTKKRFKVTGSGKVTARKAGKRHLNEHKSSRVTRRLTGETVLSKGEAAKVKKLL 61
9***********************************************************9 PP
Or compare biolip::9c4g2 to CDD or PaperBLAST