ecocyc::G7152-MONOMER has 258 amino acids
Query: DUF2135 [M=48] Accession: PF09906.13 Description: Uncharacterized protein conserved in bacteria (DUF2135) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 68.2 0.8 3.4e-22 64.6 0.4 2.4 2 ecocyc::G7152-MONOMER Domain annotation for each sequence (and alignments): >> ecocyc::G7152-MONOMER # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.0 0.023 0.023 21 38 .. 136 153 .. 128 161 .. 0.84 2 ! 64.6 0.4 3.4e-22 3.4e-22 1 48 [] 199 244 .. 199 244 .. 0.94 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.023 DUF2135 21 agpttlrltlitdEGtpn 38 +g + +rl+l+ ++t n ecocyc::G7152-MONOMER 136 TGTIRARLRLVLSWDTDN 153 678899*********987 PP == domain 2 score: 64.6 bits; conditional E-value: 3.4e-22 DUF2135 1 alkGkYkVyVNYygnrqqtlagpttlrltlitdEGtpnekrqtfvvrl 48 +++G Y+Vy+NYyg +++++tt++ltlitdEG++nek++tf+v++ ecocyc::G7152-MONOMER 199 PIHGRYQVYINYYGG--RSETELTTAQLTLITDEGSVNEKQETFIVPM 244 789***********6..45789*************************9 PP
Or compare ecocyc::G7152-MONOMER to CDD or PaperBLAST