ecocyc::MONOMER0-2674 has 77 amino acids
Query: DUF3950 [M=30]
Accession: PF13132.10
Description: Domain of unknown function (DUF3950)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-25 75.6 1.1 2e-25 74.7 1.1 1.5 1 ecocyc::MONOMER0-2674
Domain annotation for each sequence (and alignments):
>> ecocyc::MONOMER0-2674
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.7 1.1 2e-25 2e-25 1 30 [] 21 50 .. 21 50 .. 1.00
Alignments for each domain:
== domain 1 score: 74.7 bits; conditional E-value: 2e-25
DUF3950 1 mleQIeiaLekektsNFSAWVkEACRekLc 30
m+eQI+iaLe+++++NFSAWV+EACR++Lc
ecocyc::MONOMER0-2674 21 MIEQINIALEQKGSGNFSAWVIEACRRRLC 50
9***************************** PP
Or compare ecocyc::MONOMER0-2674 to CDD or PaperBLAST