metacyc::MONOMER-13358 has 181 amino acids
Query: DUF4863 [M=153] Accession: PF16155.10 Description: Domain of unknown function (DUF4863) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-52 164.3 0.0 1.2e-52 164.0 0.0 1.1 1 metacyc::MONOMER-13358 Domain annotation for each sequence (and alignments): >> metacyc::MONOMER-13358 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 164.0 0.0 1.2e-52 1.2e-52 3 153 .] 31 175 .. 29 175 .. 0.98 Alignments for each domain: == domain 1 score: 164.0 bits; conditional E-value: 1.2e-52 DUF4863 3 iaeflaeiedltldkeleerLneeygagselyedlaalirqgvaegWvakeeidGakyrrgriakpseetkgfsidvveleeedvag 89 +a++l+ ++d++ld++le Lne++ga+se+y++l +l+r+g++egW++ ++idG++y rg++ak++e+ +g+s++ +l+ +v g metacyc::MONOMER-13358 31 VASLLSFLKDKPLDQKLEVELNERFGATSEVYSNLLRLLRAGIEEGWACYAQIDGPDYCRGQLAKATENPNGYSVESGMLK--NVLG 115 788999***************************************************************************..**** PP DUF4863 90 qyHrHPyGeinlvvpldesaelkglegwqgaGWtvpgpgsaHyPevrgGaavvlflLPaGriey 153 + H HP Gein++ p+de+a+++g+ aGW+v++pgs H P+v+gG++++lf+LP G+iey metacyc::MONOMER-13358 116 NFHLHPRGEINMIGPVDEGATFCGSG----AGWKVFEPGSRHFPTVNGGKVTMLFFLPGGEIEY 175 ************************99....********************************99 PP
Or compare metacyc::MONOMER-13358 to CDD or PaperBLAST