metacyc::MONOMER-20701 has 103 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-19 56.5 0.0 1.8e-19 56.3 0.0 1.1 1 metacyc::MONOMER-20701
Domain annotation for each sequence (and alignments):
>> metacyc::MONOMER-20701
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.3 0.0 1.8e-19 1.8e-19 1 78 [. 11 88 .. 11 89 .. 0.98
Alignments for each domain:
== domain 1 score: 56.3 bits; conditional E-value: 1.8e-19
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+e+d++D ll+ +R +l +ia+yK+++g+p+++p R+ v +r+++ a+++gld++++ ++++ ii e+++++
metacyc::MONOMER-20701 11 RAELDALDGTLLDTVRRRIDLGVRIARYKSRHGVPMMQPGRVSLVKDRAARYAADHGLDESFLVNLYDVIITEMCRVE 88
99***************************************************9*******************99987 PP
Or compare metacyc::MONOMER-20701 to CDD or PaperBLAST