reanno::Cola:Echvi_0120 has 367 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-25 75.6 1.0 3.4e-25 74.6 1.0 1.6 1 reanno::Cola:Echvi_0120
Domain annotation for each sequence (and alignments):
>> reanno::Cola:Echvi_0120
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.6 1.0 3.4e-25 3.4e-25 1 79 [] 276 354 .. 276 354 .. 0.99
Alignments for each domain:
== domain 1 score: 74.6 bits; conditional E-value: 3.4e-25
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+ Id++D++l++LlaeR++++++i++ K+e++l+v++ +R++ev++ ++++ ++gl+++++++++ i++es+++Q+
reanno::Cola:Echvi_0120 276 RSAIDHMDDQLIDLLAERFAVIDQIGAHKREHKLTVFQSDRWKEVMDSRTDKGVKKGLSEKFMKELLFSIHEESVKRQE 354
899************************************************999***********************96 PP
Or compare reanno::Cola:Echvi_0120 to CDD or PaperBLAST