PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Cup4G11:RR42_RS16265 to PF06073 (DUF934)

reanno::Cup4G11:RR42_RS16265 has 193 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                     -----------
      2e-46  142.5   0.1    3.2e-46  141.9   0.1    1.3  1  reanno::Cup4G11:RR42_RS16265  


Domain annotation for each sequence (and alignments):
>> reanno::Cup4G11:RR42_RS16265  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  141.9   0.1   3.2e-46   3.2e-46       1     107 []      74     180 ..      74     180 .. 0.99

  Alignments for each domain:
  == domain 1  score: 141.9 bits;  conditional E-value: 3.2e-46
                        DUF934   1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkd 81 
                                   g++la+++++++ +a+++++a++a++fp F+DGRg+S+a+lLR+r++++g+lrA+GdvlrDql+++krcGfdaf++r+dk+
  reanno::Cup4G11:RR42_RS16265  74 GIWLAPEDEPADAQAAFASVAVVAVDFPVFRDGRGFSTAYLLRTRYNWTGQLRAIGDVLRDQLNFMKRCGFDAFAVRADKN 154
                                   89******************************************************************************* PP

                        DUF934  82 aeaaekalerfsvaYqaavdeeqplf 107
                                   +++a k +++f+vaYqa+vde+ plf
  reanno::Cup4G11:RR42_RS16265 155 IDDAIKGFTEFTVAYQASVDEPLPLF 180
                                   ************************97 PP



Or compare reanno::Cup4G11:RR42_RS16265 to CDD or PaperBLAST