reanno::DvH:206336 has 543 amino acids
Query: RACo_C_ter [M=261] Accession: PF14574.11 Description: C-terminal domain of RACo the ASKHA domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-45 139.5 0.0 8.6e-45 138.9 0.0 1.2 1 reanno::DvH:206336 Domain annotation for each sequence (and alignments): >> reanno::DvH:206336 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 138.9 0.0 8.6e-45 8.6e-45 4 249 .. 298 541 .. 296 542 .. 0.89 Alignments for each domain: == domain 1 score: 138.9 bits; conditional E-value: 8.6e-45 RACo_C_ter 4 lliDiGTNaEivlg.nkdwllaasaaaGPAlEGgeikcGmrAapgAierveidpetlevelkvignekpkGicGsGiidliaelleagiid 93 +l D+GTN+E vl + ++ l++s a GPAlEG ++++G+ A++gAi +++++p l + v+++ ++ Gi G+G i+l+ +ll+ag++d reanno::DvH:206336 298 VLADLGTNGEFVLAlSPERTLVTSVALGPALEGIGLTFGTVAQRGAITSFTLTPGGLVP--YVLDGGEADGISGTGYISLVHALLRAGLLD 386 678**********736799*************************************655..56777789********************** PP RACo_C_ter 94 kkgklnkelkserireeeeteeyvlvlaeeset..ekdivitekDidelirakaAiyagietLleevglevedidkvylaGafGsyidiek 182 +g++ ++ +s+ ++ + ++ + e + +++ +Di+e+++ kaA ++e Ll ++++ + ++ + laGa G++ +++ reanno::DvH:206336 387 VDGRFIQSPSSPLAA---RMARSIVSHRGEPCLplARGLYLAARDIEEILKVKAAFSLAFERLLATAQMPSHALSGIHLAGALGQHALPAD 474 *****7775544443...3444444443333322378****************************************************** PP RACo_C_ter 183 AitiGllPdlelekvkqvGNtslagAraallsreareeleeiarkityielavekeFmdefvaalfl 249 +G +P + ++++vGNtsl+gA+++l+s+ r++l++ ++ t ++l + ++F+ f++ + + reanno::DvH:206336 475 LEGLGFIPPGSGGRTRAVGNTSLRGAELLLTSPPLRDTLNTWREGCTVVDLTAAPDFSAAFLRHMHF 541 *************************************************************998865 PP
Or compare reanno::DvH:206336 to CDD or PaperBLAST