reanno::Koxy:BWI76_RS21010 has 63 amino acids
Query: DUF2633 [M=43]
Accession: PF11119.12
Description: Protein of unknown function (DUF2633)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-33 99.8 5.8 3.5e-33 99.6 5.8 1.1 1 reanno::Koxy:BWI76_RS21010
Domain annotation for each sequence (and alignments):
>> reanno::Koxy:BWI76_RS21010
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 99.6 5.8 3.5e-33 3.5e-33 1 43 [] 1 43 [. 1 43 [. 0.99
Alignments for each domain:
== domain 1 score: 99.6 bits; conditional E-value: 3.5e-33
DUF2633 1 mrrrrrknsrmtRiVLLISFiiLlGRlvYssiGAwehHqdKkq 43
mr+r+r+n+rmtRiVLLISFi+++GR+vYssiGAw+hHqdKkq
reanno::Koxy:BWI76_RS21010 1 MRKRHRFNRRMTRIVLLISFIFFFGRFVYSSIGAWYHHQDKKQ 43
89***************************************98 PP
Or compare reanno::Koxy:BWI76_RS21010 to CDD or PaperBLAST