reanno::Marino:GFF1282 has 88 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-38 116.5 2.5 3.1e-38 116.4 2.5 1.0 1 reanno::Marino:GFF1282
Domain annotation for each sequence (and alignments):
>> reanno::Marino:GFF1282
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 116.4 2.5 3.1e-38 3.1e-38 2 79 .] 10 86 .. 9 86 .. 0.98
Alignments for each domain:
== domain 1 score: 116.4 bits; conditional E-value: 3.1e-38
DUF4212 2 kaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
+aYw+anlrli++ L++W+lvs+g++il+++ l i ++g +lgFwfa+qgsil+f++lif Ya+rmn++D+k+gv+
reanno::Marino:GFF1282 10 EAYWKANLRLIFGSLIVWALVSYGFAILLRPMLAGI-PIGGTDLGFWFAQQGSILTFIALIFHYAWRMNKIDEKFGVH 86
79**********************************.5**************************************97 PP
Or compare reanno::Marino:GFF1282 to CDD or PaperBLAST