reanno::PV4:5209924 has 88 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.5e-39 119.1 4.1 5e-39 118.9 4.1 1.0 1 reanno::PV4:5209924
Domain annotation for each sequence (and alignments):
>> reanno::PV4:5209924
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.9 4.1 5e-39 5e-39 2 79 .] 10 86 .. 9 86 .. 0.98
Alignments for each domain:
== domain 1 score: 118.9 bits; conditional E-value: 5e-39
DUF4212 2 kaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
+ Ywr+nlrl+l+lL+iW++vsfg+gil+++ ln+i+ f+gf+lgFwfa+qg+++vfv+lifvY+ + n+lD+ky+v+
reanno::PV4:5209924 10 EGYWRENLRLVLGLLAIWAAVSFGCGILLVDVLNEIH-FMGFKLGFWFAQQGAMYVFVALIFVYVAKANALDKKYNVH 86
78**********************************6.**************************************96 PP
Or compare reanno::PV4:5209924 to CDD or PaperBLAST