reanno::Pedo557:CA265_RS11635 has 379 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-21 63.3 0.7 2.8e-21 62.0 0.7 1.7 1 reanno::Pedo557:CA265_RS11635
Domain annotation for each sequence (and alignments):
>> reanno::Pedo557:CA265_RS11635
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.0 0.7 2.8e-21 2.8e-21 1 78 [. 279 356 .. 279 357 .. 0.98
Alignments for each domain:
== domain 1 score: 62.0 bits; conditional E-value: 2.8e-21
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
Rk+Id+iD+ ll+ l eRm+++++i+e+K++n++++l+ +R+++++++ + a++l+ld +++ek+++ ++ es++ Q
reanno::Pedo557:CA265_RS11635 279 RKSIDKIDDVLLQKLGERMAIVEKIGEFKRDNQVTILQVNRWDAIIKKGHAFAKALKLDLNFTEKFLELVHGESIRKQ 356
99**************************************************************************99 PP
Or compare reanno::Pedo557:CA265_RS11635 to CDD or PaperBLAST