reanno::SB2B:6937352 has 88 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-39 119.3 7.1 4.4e-39 119.1 7.1 1.0 1 reanno::SB2B:6937352
Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6937352
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.1 7.1 4.4e-39 4.4e-39 2 79 .] 10 86 .. 9 86 .. 0.98
Alignments for each domain:
== domain 1 score: 119.1 bits; conditional E-value: 4.4e-39
DUF4212 2 kaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
+ Ywr+nlrl++ lL++Wf+vs+g+gil+++ ln+i tf+gf+lgFwfa+qgs++vfv+lif+Ya + n+lD+ky+v+
reanno::SB2B:6937352 10 QGYWRENLRLVISLLAVWFVVSYGFGILLVDVLNQI-TFMGFKLGFWFAQQGSMYVFVALIFIYAAKANALDKKYNVH 86
79**********************************.6**************************************96 PP
Or compare reanno::SB2B:6937352 to CDD or PaperBLAST