PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Smeli:SMc04383 to PF07063 (DUF1338)

reanno::Smeli:SMc04383 has 466 amino acids

Query:       DUF1338  [M=169]
Accession:   PF07063.17
Description: Domain of unknown function (DUF1338), C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    5.2e-72  227.7   0.0    7.4e-72  227.2   0.0    1.2  1  reanno::Smeli:SMc04383  


Domain annotation for each sequence (and alignments):
>> reanno::Smeli:SMc04383  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  227.2   0.0   7.4e-72   7.4e-72       2     169 .]     198     412 ..     197     412 .. 0.99

  Alignments for each domain:
  == domain 1  score: 227.2 bits;  conditional E-value: 7.4e-72
                 DUF1338   2 vsledyeeLkeeselaAdvvsfegyhiNHlTprvldidavqealeergiklkdeieGppkrspdilLrQtsfkAleeevefaeedge 88 
                             vs   ye+L+++++l+Advvsf+g+hiNHlTpr+ldid+vq+ + e gi++k+++eGpp+r++++lLrQtsfkAlee+v+f+++dg+
  reanno::Smeli:SMc04383 198 VSAGMYERLHDAHRLIADVVSFKGPHINHLTPRTLDIDRVQALMPEYGIAPKAVVEGPPTRKCPVLLRQTSFKALEEPVSFRDSDGS 284
                             56778********************************************************************************** PP

                 DUF1338  89 eeegsvtarfgEieqRgaaltpkGralydellkea..........................fpddeeelrkegLayfr......... 140
                              ++gs+tarfgEieqRg+altpkGr lyd+ll+e+                          fpd+++elr+ gL+yf+         
  reanno::Smeli:SMc04383 285 WKTGSHTARFGEIEQRGIALTPKGRGLYDRLLDESrkivrpaadgsnareyeaalaqvfeaFPDSWAELREAGLGYFSysltdkgrr 371
                             *************************************************************************************** PP

                 DUF1338 141 ............ieeglveaepilyedFlpasAagIFesnl 169
                                         i++glv+++pi+yedFlp+sAagIF+snl
  reanno::Smeli:SMc04383 372 tklpgrrdlnslIADGLVQFDPIVYEDFLPVSAAGIFQSNL 412
                             ***************************************97 PP



Or compare reanno::Smeli:SMc04383 to CDD or PaperBLAST