reanno::WCS417:GFF142 has 69 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-25 75.5 10.1 1.5e-25 75.3 10.1 1.1 1 reanno::WCS417:GFF142
Domain annotation for each sequence (and alignments):
>> reanno::WCS417:GFF142
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.3 10.1 1.5e-25 1.5e-25 1 56 [] 4 59 .. 4 59 .. 0.98
Alignments for each domain:
== domain 1 score: 75.3 bits; conditional E-value: 1.5e-25
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
++d+ Gv++p+llvl+ + +vl+l+++ ll+rl++yrlvWh+aLf+++l+++llg+
reanno::WCS417:GFF142 4 DLDISGVFLPTLLVLMGITYVLFLVVHGLLTRLHFYRLVWHRALFNVGLYALLLGA 59
689***************************************************96 PP
Or compare reanno::WCS417:GFF142 to CDD or PaperBLAST