reanno::acidovorax_3H11:Ac3H11_4058 has 169 amino acids
Query: DUF1854 [M=130] Accession: PF08909.15 Description: Domain of unknown function (DUF1854) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-51 159.5 0.0 2.2e-51 159.3 0.0 1.0 1 reanno::acidovorax_3H11:Ac3H11_4058 Domain annotation for each sequence (and alignments): >> reanno::acidovorax_3H11:Ac3H11_4058 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 159.3 0.0 2.2e-51 2.2e-51 1 130 [] 38 168 .. 38 168 .. 0.98 Alignments for each domain: == domain 1 score: 159.3 bits; conditional E-value: 2.2e-51 DUF1854 1 yegvepvrafPisapdeyislvdadgkElaliedladLdeesrklleeeLarrefvpeIkrilsvsekatpsew 74 +egv+pvrafPi+ap e++slv +dg+El++i +++++ +r+l++eeLa refvp+I++i++vs+++tps+w reanno::acidovorax_3H11:Ac3H11_4058 38 HEGVTPVRAFPIAAPGEGLSLVGSDGHELLWIPHVDQVAGPARQLIDEELAVREFVPTIEKIVAVSSFSTPSTW 111 89************************************************************************ PP DUF1854 75 eveTdrGettfvlkgeedirrlsskr.llitDsdgnryeipdlkaLdkksrklLerf 130 +veTdrG++++vlk+eedirrl +++ lli+ dg +++++d++aLd++srklLerf reanno::acidovorax_3H11:Ac3H11_4058 112 QVETDRGPASLVLKAEEDIRRLGGRTrLLIAGGDGMQFRVKDTTALDRHSRKLLERF 168 **********************98766****************************98 PP
Or compare reanno::acidovorax_3H11:Ac3H11_4058 to CDD or PaperBLAST