PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::acidovorax_3H11:Ac3H11_576 to PF06073 (DUF934)

reanno::acidovorax_3H11:Ac3H11_576 has 128 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.17
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    7.9e-40  121.3   0.2    9.5e-40  121.1   0.2    1.0  1  reanno::acidovorax_3H11:Ac3H11_576  


Domain annotation for each sequence (and alignments):
>> reanno::acidovorax_3H11:Ac3H11_576  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.1   0.2   9.5e-40   9.5e-40       2     107 .]      20     123 ..      19     123 .. 0.93

  Alignments for each domain:
  == domain 1  score: 121.1 bits;  conditional E-value: 9.5e-40
                              DUF934   2 valesdedveelaadldrlalvalefpkFtDGRgySlarlLRerlgykgelrAvGdvlrDqlallkrcGfdafel 76 
                                         val++d+d  +la  ld ++ v+l+fp+FtDGR++S+a lLR+r g++g++rA+Gdvl+Dql +++r+Gf++++l
  reanno::acidovorax_3H11:Ac3H11_576  20 VALANDAD--ALALPLDGVERVDLHFPSFTDGRAFSQAFLLRRRRGFAGDIRATGDVLIDQLVQMQRTGFSSAVL 92 
                                         45555555..55556************************************************************ PP

                              DUF934  77 radkdleaaekalerfseaYqaavdepeplf 107
                                         r++ d+++a++++erf  +Yq+++ +p+plf
  reanno::acidovorax_3H11:Ac3H11_576  93 REGVDPADAQRQFERFPGFYQGDAVNPQPLF 123
                                         *****************************98 PP



Or compare reanno::acidovorax_3H11:Ac3H11_576 to CDD or PaperBLAST