reanno::acidovorax_3H11:Ac3H11_576 has 128 amino acids
Query: DUF934 [M=107]
Accession: PF06073.17
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.9e-40 121.3 0.2 9.5e-40 121.1 0.2 1.0 1 reanno::acidovorax_3H11:Ac3H11_576
Domain annotation for each sequence (and alignments):
>> reanno::acidovorax_3H11:Ac3H11_576
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 121.1 0.2 9.5e-40 9.5e-40 2 107 .] 20 123 .. 19 123 .. 0.93
Alignments for each domain:
== domain 1 score: 121.1 bits; conditional E-value: 9.5e-40
DUF934 2 valesdedveelaadldrlalvalefpkFtDGRgySlarlLRerlgykgelrAvGdvlrDqlallkrcGfdafel 76
val++d+d +la ld ++ v+l+fp+FtDGR++S+a lLR+r g++g++rA+Gdvl+Dql +++r+Gf++++l
reanno::acidovorax_3H11:Ac3H11_576 20 VALANDAD--ALALPLDGVERVDLHFPSFTDGRAFSQAFLLRRRRGFAGDIRATGDVLIDQLVQMQRTGFSSAVL 92
45555555..55556************************************************************ PP
DUF934 77 radkdleaaekalerfseaYqaavdepeplf 107
r++ d+++a++++erf +Yq+++ +p+plf
reanno::acidovorax_3H11:Ac3H11_576 93 REGVDPADAQRQFERFPGFYQGDAVNPQPLF 123
*****************************98 PP
Or compare reanno::acidovorax_3H11:Ac3H11_576 to CDD or PaperBLAST