reanno::psRCH2:GFF345 has 87 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-35 107.0 2.8 2.9e-35 106.9 2.8 1.0 1 reanno::psRCH2:GFF345
Domain annotation for each sequence (and alignments):
>> reanno::psRCH2:GFF345
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 106.9 2.8 2.9e-35 2.9e-35 2 79 .] 10 86 .. 9 86 .. 0.97
Alignments for each domain:
== domain 1 score: 106.9 bits; conditional E-value: 2.9e-35
DUF4212 2 kaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
aYw+an+rli++ Lv+W+lvs+g+gil+++ + i ++g +lgFwfa+qgsi++f+++if Ya+r n+lD+++gve
reanno::psRCH2:GFF345 10 AAYWKANVRLITWSLVVWALVSYGFGILLRPLVAGI-PVGGTDLGFWFAQQGSIITFIAIIFHYAWRLNKLDKEFGVE 86
69**********************************.5**************************************95 PP
Or compare reanno::psRCH2:GFF345 to CDD or PaperBLAST