reanno::pseudo13_GW456_L13:PfGW456L13_2842 has 164 amino acids
Query: DUF934 [M=107] Accession: PF06073.16 Description: Bacterial protein of unknown function (DUF934) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-49 152.2 0.1 2.4e-49 151.9 0.1 1.1 1 reanno::pseudo13_GW456_L13:PfGW456L13_2842 Domain annotation for each sequence (and alignments): >> reanno::pseudo13_GW456_L13:PfGW456L13_2842 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 151.9 0.1 2.4e-49 2.4e-49 1 107 [] 55 161 .. 55 161 .. 0.99 Alignments for each domain: == domain 1 score: 151.9 bits; conditional E-value: 2.4e-49 DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellk 67 g++l++de++ee+ +d++++++ial+fp+FtDGR yS arlLR+r+g+kgelrA+GdvlrDql++++ reanno::pseudo13_GW456_L13:PfGW456L13_2842 55 GIWLDADEEAEEIGEDVAQFQVIALNFPAFTDGRNYSNARLLRDRYGFKGELRAIGDVLRDQLFYMH 121 89***************************************************************** PP DUF934 68 rcGfdafelredkdaeaaekalerfsvaYqaavdeeqplf 107 rcGfdaf++r+dkd+++a + l++fsv+Yqaa+de+ plf reanno::pseudo13_GW456_L13:PfGW456L13_2842 122 RCGFDAFAIRADKDPHEALEGLKDFSVTYQAAADEPLPLF 161 **************************************97 PP
Or compare reanno::pseudo13_GW456_L13:PfGW456L13_2842 to CDD or PaperBLAST