reanno::pseudo3_N2E3:AO353_04830 has 66 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-24 71.7 6.5 2.4e-24 71.4 6.5 1.1 1 reanno::pseudo3_N2E3:AO353_04830
Domain annotation for each sequence (and alignments):
>> reanno::pseudo3_N2E3:AO353_04830
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.4 6.5 2.4e-24 2.4e-24 1 56 [] 4 59 .. 4 59 .. 0.99
Alignments for each domain:
== domain 1 score: 71.4 bits; conditional E-value: 2.4e-24
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
Ei++ Gvy+p++ +++++A ++ ++l+r l+ + lyr++WhpaL++l+lf cl+g+
reanno::pseudo3_N2E3:AO353_04830 4 EIAFHGVYMPTMTLMFFIAAAMAWALDRFLSGFDLYRFFWHPALLRLSLFTCLFGA 59
9*****************************************************96 PP
Or compare reanno::pseudo3_N2E3:AO353_04830 to CDD or PaperBLAST