reanno::pseudo5_N2C3_1:AO356_00560 has 164 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-49 152.4 0.1 2.2e-49 152.1 0.1 1.1 1 reanno::pseudo5_N2C3_1:AO356_00560
Domain annotation for each sequence (and alignments):
>> reanno::pseudo5_N2C3_1:AO356_00560
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 152.1 0.1 2.2e-49 2.2e-49 1 107 [] 55 161 .. 55 161 .. 0.99
Alignments for each domain:
== domain 1 score: 152.1 bits; conditional E-value: 2.2e-49
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafe 75
gv+l++de++ee+ +d ++l++ial+fp+FtDGR yS arlLR+r+g+kgelrA+GdvlrDql++++rcGfdaf+
reanno::pseudo5_N2C3_1:AO356_00560 55 GVWLDADEEAEEIGDDANQLQVIALNFPAFTDGRSYSNARLLRDRYGFKGELRAIGDVLRDQLFYMRRCGFDAFA 129
8************************************************************************** PP
DUF934 76 lredkdaeaaekalerfsvaYqaavdeeqplf 107
lr+dkd+ +a ++l++fsv+Yqaa+de+ plf
reanno::pseudo5_N2C3_1:AO356_00560 130 LRADKDPYEALESLKDFSVTYQAATDEPLPLF 161
******************************97 PP
Or compare reanno::pseudo5_N2C3_1:AO356_00560 to CDD or PaperBLAST