reanno::pseudo6_N2E2:Pf6N2E2_159 has 82 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-34 104.3 0.0 1.3e-34 104.1 0.0 1.0 1 reanno::pseudo6_N2E2:Pf6N2E2_159
Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_159
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 104.1 0.0 1.3e-34 1.3e-34 2 70 .] 13 81 .. 12 81 .. 0.98
Alignments for each domain:
== domain 1 score: 104.1 bits; conditional E-value: 1.3e-34
DUF1654 2 syerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerple 70
sy rlg+Rv++iinaP+aQk+++a+++rl++e ++W+rllee++e+++v+la++dDg+v+v+W +p+e
reanno::pseudo6_N2E2:Pf6N2E2_159 13 SYTRLGLRVSKIINAPTAQKAKAALIFRLPDEPVDEWERLLEEIDENDNVTLAYRDDGGVQVFWVVPKE 81
8***************************************************************99875 PP
Or compare reanno::pseudo6_N2E2:Pf6N2E2_159 to CDD or PaperBLAST