reanno::pseudo6_N2E2:Pf6N2E2_2074 has 164 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-49 151.2 0.1 4.9e-49 150.9 0.1 1.1 1 reanno::pseudo6_N2E2:Pf6N2E2_2074
Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_2074
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 150.9 0.1 4.9e-49 4.9e-49 1 107 [] 55 161 .. 55 161 .. 0.99
Alignments for each domain:
== domain 1 score: 150.9 bits; conditional E-value: 4.9e-49
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafel 76
gv+l++de++ee+ +d ++l++ial+fp+FtDGR yS arlLR+r+g+kgelrA+GdvlrDql++++rcGfdaf+l
reanno::pseudo6_N2E2:Pf6N2E2_2074 55 GVWLDADEEAEEIGEDANQLQVIALNFPAFTDGRSYSNARLLRDRYGFKGELRAIGDVLRDQLFYMRRCGFDAFAL 130
8*************************************************************************** PP
DUF934 77 redkdaeaaekalerfsvaYqaavdeeqplf 107
r+dkd+ +a ++l++fsv+Yqaa+de+ plf
reanno::pseudo6_N2E2:Pf6N2E2_2074 131 RADKDPFEALESLKDFSVTYQAATDEPLPLF 161
*****************************97 PP
Or compare reanno::pseudo6_N2E2:Pf6N2E2_2074 to CDD or PaperBLAST