P38301 has 280 amino acids
Query: UPF0016 [M=75] Accession: PF01169.23 Description: Uncharacterized protein family UPF0016 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-47 145.5 23.0 1.3e-27 82.3 5.5 2.3 2 P38301 Domain annotation for each sequence (and alignments): >> P38301 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.0 9.5 1.8e-23 1.8e-23 2 75 .] 44 117 .. 43 117 .. 0.98 2 ! 82.3 5.5 1.3e-27 1.3e-27 2 75 .] 195 268 .. 194 268 .. 0.98 Alignments for each domain: == domain 1 score: 69.0 bits; conditional E-value: 1.8e-23 UPF0016 2 tsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaavlFlvfG 75 +s+++i l+E+GDkT+l+++++A+r+k + Vf +a++ la++t+l+ ++G+ +l+er++ ++a++lFlvfG P38301 44 MSVSMIGLSEIGDKTFLIAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFG 117 7899*********************************************************************9 PP == domain 2 score: 82.3 bits; conditional E-value: 1.3e-27 UPF0016 2 tsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaavlFlvfG 75 ++fl++fl+ElGD++q+ +ia+A+ ++++ V++Ga++++a++++lav++G+lla+r++ r+++l++ +lF++f+ P38301 195 QIFLMVFLGELGDRSQISIIAMATDSDYWYVIAGAVIGHAICSGLAVVGGKLLATRISIRTITLASSLLFFIFA 268 89***********************************************************************7 PP
Or compare P38301 to CDD or PaperBLAST