REBASE::M.Ple25539I has 489 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-13 35.1 0.0 1.1e-12 34.2 0.0 1.4 1 REBASE::M.Ple25539I Domain annotation for each sequence (and alignments): >> REBASE::M.Ple25539I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.2 0.0 1.1e-12 1.1e-12 19 148 .. 175 296 .. 169 351 .. 0.77 Alignments for each domain: == domain 1 score: 34.2 bits; conditional E-value: 1.1e-12 UPF0020 19 alvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelk...lygsDldrrvvqgareNaekagvgdl. 104 +vrl ++++++ DP CG+ ++lI a ++ + e+ e+ ++ + g+D dr +++ + N+ +++ REBASE::M.Ple25539I 175 MMVRLLAPTPDDKICDPACGTAGFLISSAEYIREKYEA-----------EMTSEQWDHFAggmFSGFDTDRTMLRLSAMNLMLHSINQPn 253 69***************************999999932...........22333333333456*******************99998753 PP UPF0020 105 iefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148 i++++ + + ++e+d++++npP+ ++++ ++L + REBASE::M.Ple25539I 254 IDYVDSVSK-QNDITSEYDIVLANPPFTGTVDAESIHDNLKTVC 296 777775444.4447789**********99998888777776655 PP
Or compare REBASE::M.Ple25539I to CDD or PaperBLAST