VIMSS2124107 has 251 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-12 33.3 0.2 3e-12 32.7 0.2 1.2 1 VIMSS2124107 Domain annotation for each sequence (and alignments): >> VIMSS2124107 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.7 0.2 3e-12 3e-12 69 127 .. 54 112 .. 29 114 .. 0.81 Alignments for each domain: == domain 1 score: 32.7 bits; conditional E-value: 3e-12 UPF0020 69 aeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127 ++ ++++ ++ g+Dld++++++ar+N ++ +++d+i+++ a+a+kL+ +++++d+++ VIMSS2124107 54 IQIAKQYGCHITGIDLDEEALDKARSNIKENNLEDFIQVQRANATKLPFEDNSFDIVIN 112 3333336666**************************************7777****995 PP
Or compare VIMSS2124107 to CDD or PaperBLAST