VIMSS297276 has 251 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-12 33.3 0.1 3e-12 32.7 0.1 1.3 1 VIMSS297276
Domain annotation for each sequence (and alignments):
>> VIMSS297276
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.7 0.1 3e-12 3e-12 76 127 .. 61 112 .. 22 114 .. 0.85
Alignments for each domain:
== domain 1 score: 32.7 bits; conditional E-value: 3e-12
UPF0020 76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
++ ++Dld++v+++a+eN +ka+++++ie+ q +a kL+ +++++d+++
VIMSS297276 61 SCHITALDLDSKVIEKAKENVKKAQLEEFIEVIQGNALKLPFPDNSFDIVIN 112
44599************************************9999****995 PP
Or compare VIMSS297276 to CDD or PaperBLAST