VIMSS5814385 has 517 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-12 33.4 0.0 2.9e-12 32.8 0.0 1.3 1 VIMSS5814385 Domain annotation for each sequence (and alignments): >> VIMSS5814385 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.8 0.0 2.9e-12 2.9e-12 19 146 .. 201 322 .. 196 376 .. 0.82 Alignments for each domain: == domain 1 score: 32.8 bits; conditional E-value: 2.9e-12 UPF0020 19 alvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeear...aelklygsDldrrvvqgareNaekagvgdl.iefsqad 111 +v+l + + ++++ DP G+ ++l+E a ++ + e+ ++ +e+r ++ + g D d+ +++ + N + gv++ +e+++ VIMSS5814385 201 MIVELMNPQVTDKICDPAAGTAGFLVESAEFLQDKKK----EE-IFYN----KENRhyfHNEMFTGYDTDQTMLRIGAMNMLSHGVDNPnVEYQDSL 288 589999***********************99999882....22.2222....222222344459**********************98637777766 PP UPF0020 112 aakLrlkegevdvivtnpPYGerlgskkalekLYs 146 + + +++e+ +i +npP+ +l+ + ++L + VIMSS5814385 289 SEQNT-DRDEYSLIMANPPFKGSLDYNSVSKDLLK 322 66666.888***********999988777776655 PP
Or compare VIMSS5814385 to CDD or PaperBLAST