VIMSS755798 has 212 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-12 31.5 0.1 2.1e-11 30.0 0.1 1.6 1 VIMSS755798
Domain annotation for each sequence (and alignments):
>> VIMSS755798
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 30.0 0.1 2.1e-11 2.1e-11 67 132 .. 69 133 .. 45 141 .. 0.86
Alignments for each domain:
== domain 1 score: 30.0 bits; conditional E-value: 2.1e-11
UPF0020 67 aeaeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYG 132
a + ar+ k++++++d+ ++ a++Na+ +gv++li+f+ d+ ++ +e + d+++ +pP+G
VIMSS755798 69 GSAIALARTGKKVIAIEMDSVRLAMAKNNARVYGVEHLITFVHGDFFDVA-AEIKADAVLIDPPWG 133
55666777778899************************************.8889**********9 PP
Or compare VIMSS755798 to CDD or PaperBLAST