VIMSS852169 has 484 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-13 34.9 0.0 1.2e-12 34.0 0.0 1.4 1 VIMSS852169 Domain annotation for each sequence (and alignments): >> VIMSS852169 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.0 0.0 1.2e-12 1.2e-12 19 146 .. 170 290 .. 165 347 .. 0.76 Alignments for each domain: == domain 1 score: 34.0 bits; conditional E-value: 1.2e-12 UPF0020 19 alvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgd.liefsqadaakL 115 +v+l + ++++ ++DP Gs ++l+ a+ ++ l +l + ++e++++ +yg+D+dr +++ + N g+++ ie+++ + VIMSS852169 170 MMVELMKPTPEDIIVDPAAGSAGFLVAAGEYLRKHRSDL------FLVQSLKEHFNN-HMFYGFDMDRTMLRIGAMNMMLHGIENpNIEYRDSLSEQN 260 69***************************9998888544......466777776665.459**********************983599999888887 PP UPF0020 116 rlkegevdvivtnpPYGerlgskkalekLYs 146 + +++++ ++++npP+ +l+ ++L + VIMSS852169 261 K-DKDKYTLVLANPPFKGSLDYDAVSNDLLK 290 7.888***********999987766666654 PP
Or compare VIMSS852169 to CDD or PaperBLAST