PaperBLAST – Find papers about a protein or its homologs

 

Align WP_041690556.1 to PF01205 (UPF0029)

WP_041690556.1 has 202 amino acids

Query:       UPF0029  [M=106]
Accession:   PF01205.23
Description: Uncharacterized protein family UPF0029
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.5e-41  124.8   0.0    9.8e-41  124.4   0.0    1.2  1  WP_041690556.1  


Domain annotation for each sequence (and alignments):
>> WP_041690556.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  124.4   0.0   9.8e-41   9.8e-41       2     104 ..      21     120 ..      20     122 .. 0.96

  Alignments for each domain:
  == domain 1  score: 124.4 bits;  conditional E-value: 9.8e-41
         UPF0029   2 kSkFiahaapveseeeakelleelkkehkkAtHnvyAyrlegedeierssddgEpsgtAGkpilevlekeeltnvlvvvtRyfGGikLGagglvr 96 
                     kSkFi+++ap++seeeak++l+++kk h+kAtH+++Ayr+ g  eiers+ddgEp+++AG p+l+vl++++l+ v++vv+Ry+GG++LG+ggl+r
  WP_041690556.1  21 KSKFIGFLAPINSEEEAKAYLKSIKKMHPKATHHCSAYRT-G--EIERSNDDGEPASSAGLPMLQVLRGHKLEGVIAVVVRYYGGVLLGVGGLIR 112
                     9**************************************9.4..5789*********************************************** PP

         UPF0029  97 ayskaake 104
                     ay ++++ 
  WP_041690556.1 113 AYGSTVSL 120
                     ***99875 PP



Or compare WP_041690556.1 to CDD or PaperBLAST