Q9LK65 has 661 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-52 163.3 7.4 3.6e-52 162.7 7.4 1.3 1 Q9LK65 Domain annotation for each sequence (and alignments): >> Q9LK65 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.7 7.4 3.6e-52 3.6e-52 1 181 [] 163 340 .. 163 340 .. 0.98 Alignments for each domain: == domain 1 score: 162.7 bits; conditional E-value: 3.6e-52 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilvfGEi 103 li+++ll lsaffs+aEt++++l + +++elaek+ ++ + l+++ +r+L+t+lig t+vni+++al+t++++ ++ g+++v +at+++t++il+++Ei Q9LK65 163 LILAALLSLSAFFSMAETSITTLWPWKVRELAEKE-PENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIF--GEAGVSAATGLMTVAILLLTEI 262 5789999**************************97.99999**************************************..799******************* PP CNNM 104 lPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieeee 181 +Pk++a++na+++a +v++p+ +ls++lyP+ +++++l+ +il++lG k+++ep+vte+el+ +++ +e +G+ieeee Q9LK65 263 TPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYLSMGILKILGLKGRSEPYVTEDELKLMLRGAELSGAIEEEE 340 ***************************************************************************998 PP
Or compare Q9LK65 to CDD or PaperBLAST