SwissProt::A0A0B7P9G0 has 834 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-36 111.6 0.8 2.9e-36 110.9 0.2 1.6 2 SwissProt::A0A0B7P9G0 Domain annotation for each sequence (and alignments): >> SwissProt::A0A0B7P9G0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.9 0.2 2.9e-36 2.9e-36 1 181 [] 191 361 .. 191 361 .. 0.93 2 ? -3.3 0.0 0.33 0.33 23 63 .. 526 566 .. 524 569 .. 0.76 Alignments for each domain: == domain 1 score: 110.9 bits; conditional E-value: 2.9e-36 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgn....kgakrllkllenperlLstlligntlvnillsalatalfaellaegal 84 +i++ +l +sa+fs+++++l+s+++++l+ l+++g+ k+a+++ +++++ + lL ++l+gn lvn ++l++ l + l+a SwissProt::A0A0B7P9G0 191 IIIVTCLGFSALFSGLNLGLMSMDRTELKILRNTGTekekKYASKIAPVRDQGNYLLCSILLGNVLVNSTFTILLDGLTSGLFA---- 274 68999***********************66655555444499999**************************************7.... PP CNNM 85 avviatviv.tllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslvees 171 vi+ tl+i++fGEi+P++++ ++ ++i +++ ++++++ +++Pl+++++++++++l ++e ++++ +e l++lv++ SwissProt::A0A0B7P9G0 275 ------VIFsTLAIVLFGEITPQAVCSRHGLAIGAKTILVTKTVMAITAPLSYPVSRILDKLL-----GEEIGNVYNRERLKELVRVT 351 ......7777*****************************************************.....9******************* PP CNNM 172 eeeGvieeee 181 + ++++++e SwissProt::A0A0B7P9G0 352 NDVNDLDKNE 361 *999999876 PP == domain 2 score: -3.3 bits; conditional E-value: 0.33 CNNM 23 lsklrleelaekgnkgakrllkllenperlLstlligntlv 63 ++++r ++ + + ++ + +++++ p+ +L+t + + t v SwissProt::A0A0B7P9G0 526 TRRNRYKKADFSAFAERREVQTVRISPQLTLATFQYLSTAV 566 56667766666666666779999999999999999988876 PP
Or compare SwissProt::A0A0B7P9G0 to CDD or PaperBLAST