SwissProt::Q9GYL2 has 760 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-32 97.1 1.3 8.3e-32 96.4 1.3 1.3 1 SwissProt::Q9GYL2 Domain annotation for each sequence (and alignments): >> SwissProt::Q9GYL2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.4 1.3 8.3e-32 8.3e-32 2 146 .. 155 294 .. 154 320 .. 0.88 Alignments for each domain: == domain 1 score: 96.4 bits; conditional E-value: 8.3e-32 CNNM 2 iallllllsaffsaaEtAlvslsklrl....eelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavvia 89 i++ll+ +sa++s+++++l++l++ +l ++ ++ ++k+a+++++++ + +rlL t++i+n +vn+++++l++ l++ l+a SwissProt::Q9GYL2 155 ILCLLFSISALCSGLTLGLMALTPQELsilmKSGSQREKKHAAAIYPIRCHGNRLLCTVIIMNVIVNTGITLLFDDLAEGLIA--------- 237 679999*********************66665555555699999*************************************95......... PP CNNM 90 tvivtllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlil 146 +v+ t+ i+vfGEilP+++++k+ +++ ++ +++++++ll+P++w+l++++++ SwissProt::Q9GYL2 238 FVASTVGIVVFGEILPQSICVKYGLAVGANTIFITKFFMFLLFPITWPLGKILDKYA 294 6777*************************************************9877 PP
Or compare SwissProt::Q9GYL2 to CDD or PaperBLAST