WP_006988793.1 has 440 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-38 118.7 5.6 1.7e-38 118.2 5.6 1.2 1 WP_006988793.1 Domain annotation for each sequence (and alignments): >> WP_006988793.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 118.2 5.6 1.7e-38 1.7e-38 2 177 .. 25 204 .. 23 208 .. 0.94 Alignments for each domain: == domain 1 score: 118.2 bits; conditional E-value: 1.7e-38 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellae.......galavvia 89 ++++ll+ sa+ s+aE+A++sl+++ + k++ k + klle+p++lL+t+l+ n+ +ni++ +l+++l e++++ ++ +vi WP_006988793.1 25 AVFVLLIGSALISGAEVAFFSLTPANFITVNGKRSNTQKIVVKLLEKPKKLLATILVANNSINIAIVLLFDTLTDEFFGNmntlvfgIDFKFVIE 119 456777****************************99*************************************************9988999*** PP CNNM 90 tvivtllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvi 177 +++vt+lil+fGEilPk +a +n+ k++ ++a+pl+vl +l++Pl++++++++ +i l ++++++++ ++l + +e+ +ee++ WP_006988793.1 120 VGVVTFLILLFGEILPKVYASRNNVKFSNFMAYPLNVLDTLFAPLSIPMRAITLFIHERL---GKQRSYISIDQLSQALELTREEETS 204 *****************************************************9999555...589******************9764 PP
Or compare WP_006988793.1 to CDD or PaperBLAST